line_1_aa31-60_sample5 Domain 1 Parse 1 Confidence: n/a
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
642574 | Complete | Structure prediction | katafotic | line_1_aa31-60_sample5 | 30 | 15 Nov 2024 | 30 Dec 2024 |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
636178 | 1 | 1 | 0.66 | RoseTTAFold | 1-30 | 30 | 15 Nov 2024 |
1 . 10 . 20 . 30
sequence: PTPGCTGSGHVRGKYSRHRSLQSCPLAKKR
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington