Full sequence Structure of hyaluronidase ph_20 homo sapience Domain 1 Parse 1 Confidence: 0.10
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 639088 | Active | Structure prediction | faezeh.kayedi7@gmail.com | Full sequence Structure o... | 509 | 30 Oct 2024 | 7 Jan 2025 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 636294 | 1 | 1 | 0.10 | comparative modeling | 1-40 | 40 | 15 Nov 2024 |
1 . 10 . 20 . 30 . 40
sequence: MGVLKFKHIFFRSFVKSSGVSQIVFTFLLIPCCLTLNFRA
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington