cter_gfg_mt_abi_ Domain 1 Parse 1 Confidence: 0.17
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
643557 | Complete | Structure prediction | mtaghizadeh | cter_gfg_mt_abi_ | 60 | 19 Nov 2024 | 4 Jan 2025 |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
637151 | 1 | 1 | 0.17 | ab initio | 1-60 | 60 | 19 Nov 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60
sequence: NQEYLDLSMPLDQYSPSFPDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR
psipred: ----EE------------------------------------------------------
spider3: ------------------------------------------------------------
deepconcnf: ----E---------------------------------------------------EE--
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington