1xbp_L32 Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 643629 | Complete | Structure prediction | marionlopresti@vt.edu | 1xbp_L32 | 59 | 19 Nov 2024 | 3 Jan 2025 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 637214 | 1 | 1 | 0.74 | RoseTTAFold | 1-59 | 59 | 19 Nov 2024 |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: AKHPVPKKKTSKSKRDMRRSHHALTAPNLTECPQCHGKKLSHHICPNCGYYDGRQVLAV
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington