1aa2-19tk1 Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 646653 | Complete | Structure prediction | gsdsdt | 1aa2-19tk1 | 108 | 2 Dec 2024 | 16 Jan 2025 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 640152 | 1 | 1 | 0.88 | RoseTTAFold | 1-108 | 108 | 2 Dec 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 .
sequence: EVEPGELLDWLQEITKGFPGVSLTNFVSPFRNGMLLAHLIYAHDPELFELEEFDLGDRAENHKLAGDIAEEKYGIPKLLDPEDLTTEEGDEELLFDFIEKLIEKITTG
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington