ranked_0.pdb Domain 1 Parse 1 Confidence: n/a
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
646818 | Complete | Structure prediction | miladkheirvari | ranked_0.pdb | 75 | 2 Dec 2024 | 16 Jan 2025 |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
640317 | 1 | 1 | n/a | comparative modeling | 1-75 | 75 | 2 Dec 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 .
sequence: SRTAVLLAMLGGAVLGVYLARRGASPAPGGPAPSPAGGQDRICPQVIATCADGSEVPTPCDCAGRGGVARLGGIA
>640317
SRTAVLLAMLGGAVLGVYLARRGASPAPGGPAPSPAGGQDRICPQVIATCADGSEVPTPCDCAGRGGVARLGGIA
>user1_w100 weight: 1.0000 score: 0.0 eval: n/a prob: n/a identity: 1.0000 startpos: 1
SRTAVLLAMLGGAVLGVYLARRGASPAPGGPAPSPAGGQDRICPQVIATCADGSEVPTPCDCAGRGGVARLGGIA
Powered by MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington