ranked_0.pdb Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
646818CompleteStructure prediction miladkheirvariranked_0.pdb752 Dec 202416 Jan 2025
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
64031711n/acomparative modeling1-75752 Dec 2024
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
   sequence: SRTAVLLAMLGGAVLGVYLARRGASPAPGGPAPSPAGGQDRICPQVIATCADGSEVPTPCDCAGRGGVARLGGIA
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington