2024-12-07_00000280_1_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 647712 | Complete | Structure prediction | RoseTTAFold | 2024-12-07_00000280_1_19 | 124 | 7 Dec 2024 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 641178 | 1 | 1 | 0.67 | RoseTTAFold | 1-124 | 124 | 7 Dec 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120
sequence: SHMSFAFPLVQSPNKQKEEMNKVHNIKCHFDNCNRKIHWKIRYGKLRLVDHALSHQEEKSIDCQKCEYSCQTTRQMRYHYKKIHANLKMEGFGILNIPLQNTKFSDVWNKCFGDQLKTIGPVRK
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington