FenC-2 Domain 1 Parse 1 Confidence: n/a
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
648330 | Complete | Structure prediction | SUBRAMANIAN K | FenC-2 | 76 | 10 Dec 2024 | 24 Jan 2025 |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
641763 | 1 | 1 | 0.93 | RoseTTAFold | 1-76 | 76 | 10 Dec 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 .
sequence: APVNELQGMTAQIWEDVLSVSRVGIHDSFFELGGDSIKALQVSARLAAEGWSMTISDLFRYPTVHELSGHITPLIS
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington