0217-27k-2 Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
648416CompleteStructure prediction gsdsdt0217-27k-210011 Dec 202425 Jan 2025
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
641850110.91RoseTTAFold1-10010011 Dec 2024
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
   sequence: SPKCQQMIEIAESLLKEVRGLLKVLEAIVKELVGKGDEEVAKELEKTVEKMVERVERARECREKAQEDYRRGKPEAAKVNVRRAFELAAEIFGVLQSWVE
| | View
Powered by 3Dmol.js




Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington