2024-12-14_00000475_2_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 648854 | Complete | Structure prediction | RoseTTAFold | 2024-12-14_00000475_2_19 | 95 | 14 Dec 2024 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 642298 | 1 | 1 | 0.77 | RoseTTAFold | 7-95 | 89 | 14 Dec 2024 |
10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 .
sequence: GSSPKEEKFKKKLEEELKKIRERLLMVFDEERVEEYMKIMKEVIEKILENRKKGSKEKVEIPPGMEWFYENFLRYYDYEEEKLEKEEKE
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington