2024-12-14_00000209_1_19 Domain 2 Parse 1 Confidence: 0.52

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
648818CompleteStructure predictionRoseTTAFold2024-12-14_00000209_1_19125514 Dec 2024-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
642333210.52comparative modeling1144-11995615 Dec 2024
              . 1150    . 1160    . 1170    . 1180    . 1190    .    
   sequence: PDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVW
    psipred: -------HHH--HHHHHHHHHHHHHHHHHHHHHHHH--HHHH--EEEEEE------
    spider3: -------HHH-------HHHHHHHHHHHHHHHH-----HHHH---EE---------
 deepconcnf: ----------HHHHH--HHHHHHHHHHHHHHHH-----HHHHHHHHHH--------
| | View
Powered by 3Dmol.js
| | Alignment


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Alignment cluster 5 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington