2025-01-11_00000127_1_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 653204 | Complete | Structure prediction | RoseTTAFold | 2025-01-11_00000127_1_19 | 107 | 11 Jan 2025 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 646544 | 1 | 1 | 0.91 | RoseTTAFold | 1-99 | 99 | 11 Jan 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 .
sequence: MLFEGDKFVGSFENAAAGTFVLDMYAYERLANSISTEKLRQYASTYNKYKYYSGSASEADYRLACFAHLAKAMMDYASNHNDTLYTPPTVSYNSTLQLE
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington