nmb-54k9 Domain 1 Parse 1 Confidence: n/a
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
654382 | Complete | Structure prediction | gsdsdt | nmb-54k9 | 62 | 16 Jan 2025 | 2 Mar 2025 |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
647631 | 1 | 1 | 0.80 | RoseTTAFold | 1-62 | 62 | 16 Jan 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60
sequence: GFPEEILPEAEEKLAKATKAGDEDACEGAIEELLKEIKIGYSPEEAEARVEELANKALKEIA
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington