2025-01-25_00000022_1_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 655518 | Complete | Structure prediction | RoseTTAFold | 2025-01-25_00000022_1_19 | 100 | 25 Jan 2025 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 648729 | 1 | 1 | 0.80 | RoseTTAFold | 13-100 | 88 | 25 Jan 2025 |
. 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100
sequence: SSGHENLYFQGQQDKLVLRVDGILNELDAQVLEGILTRLNGVRQFRLDRISGELEVVFDPEVVSSRSLVDGIEEDGFGKFKLRVMSPY
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington