2025-03-15_00000118_2_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 661784 | Complete | Structure prediction | RoseTTAFold | 2025-03-15_00000118_2_19 | 45 | 15 Mar 2025 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 654701 | 1 | 1 | 0.75 | RoseTTAFold | 1-45 | 45 | 15 Mar 2025 |
1 . 10 . 20 . 30 . 40 .
sequence: KHKHEMTLKFGPARNDSVIVADQTPTPTRFLKNCEEVGLFNELAS
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington