Seq1 Domain 1 Parse 1 Confidence: n/a
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
663658 | Complete | Structure prediction | shah | Seq1 | 54 | 26 Mar 2025 | 18 May 2025 |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
656183 | 1 | 1 | 0.60 | RoseTTAFold | 1-54 | 54 | 3 Apr 2025 |
1 . 10 . 20 . 30 . 40 . 50
sequence: MGKATWGSRPRHGPRWAPILLTSWHRERSPSGSLGGAWAPSGPVTMETAVLSCL
|
|
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington