trial Domain 1 Parse 1 Confidence: n/a
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
663716 | Complete | Structure prediction | Nithin123 | trial | 67 | 27 Mar 2025 | 18 May 2025 |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
656204 | 1 | 1 | 0.57 | RoseTTAFold | 1-67 | 67 | 3 Apr 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 .
sequence: HNCILYTEGCRWGLIPNMNLNDVRDWWRYWWPMGPLLLHEWTSLKPPNWPLPEPESYTLLFHLEWYL
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington