| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 663241 | Error | Structure prediction | cameo | 2025-03-22_00000211_1_11 | 53 | 22 Mar 2025 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 656468 | 1 | 1 | n/a | TrRefineRosetta | 1-47 | 47 | 3 Apr 2025 |
1 . 10 . 20 . 30 . 40 .
sequence: MGKIKRFFAKDMRAALAQVKDTLGSDAVIMSNKKVNGGIEIVAAVLE
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington