2025-05-17_00000111_full_11 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 670350 | Error | Structure prediction | cameo | 2025-05-17_00000111_full_... | 94 | 17 May 2025 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 662657 | 1 | 1 | n/a | TrRefineRosetta | 1-94 | 94 | 17 May 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90
sequence: GSHMASMSDEQAEARAFLSEEMIAEFKAAFDMFDADGGGEISAKAFGTVARMNNVPVDPRVQEYVKRLTDQDGSGTISFEEFLVLMVKSMKQDA
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington