2025-05-17_00000209_full_11 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 670359 | Error | Structure prediction | cameo | 2025-05-17_00000209_full_... | 183 | 17 May 2025 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 662669 | 1 | 1 | n/a | TrRefineRosetta | 1-183 | 183 | 17 May 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180
sequence: ITALETAIILIAFVVVASVFAFTILSAGTFSTERGKEAVYAGLSEVRSSIEIKGSVVIIGETTGATGTVDSVIFTVASAAGGEPIDLNNDPDDRVVVIDYRDATQRHTDVDWSVTWLGKNDYDTTGDTLLEQGELAEITVTLAPTITLSTNTDFIIEVKPPAGAVFSIQRTTPAYIETVNDLQ
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington