2025-07-26_00000277_full_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 684039 | Complete | Structure prediction | RoseTTAFold | 2025-07-26_00000277_full_... | 114 | 26 Jul 2025 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 675859 | 1 | 1 | 0.53 | RoseTTAFold | 25-114 | 90 | 26 Jul 2025 |
30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110
sequence: APRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPM
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington