2025-08-16_00000346_full_11 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 686163 | Error | Structure prediction | cameo | 2025-08-16_00000346_full_... | 50 | 16 Aug 2025 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 677991 | 1 | 1 | n/a | TrRefineRosetta | 1-50 | 50 | 18 Aug 2025 |
1 . 10 . 20 . 30 . 40 . 50
sequence: EYHLMNGANGYLTRVNGKYVYRVTKDPVSAVFGVISNGWGSAGAGFGPQH
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington