2025-08-16_00000346_full_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 686164 | Complete | Structure prediction | RoseTTAFold | 2025-08-16_00000346_full_... | 50 | 16 Aug 2025 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 677992 | 1 | 1 | 0.58 | RoseTTAFold | 1-50 | 50 | 18 Aug 2025 |
1 . 10 . 20 . 30 . 40 . 50
sequence: EYHLMNGANGYLTRVNGKYVYRVTKDPVSAVFGVISNGWGSAGAGFGPQH
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington