2025-08-16_00000263_full_19 Domain 2 Parse 1 Confidence: 0.42
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 686156 | Active | Structure prediction | RoseTTAFold | 2025-08-16_00000263_full_... | 1229 | 16 Aug 2025 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 678000 | 2 | 1 | 0.42 | comparative modeling | 1125-1229 | 105 | 18 Aug 2025 |
1130 . 1140 . 1150 . 1160 . 1170 . 1180 . 1190 . 1200 . 1210 . 1220 .
sequence: NHTSPDVDFDDISGINASVVDIKKEIEHLNEIAKSLNESLIDLQELGKYEQYIKWPWGGGSGGGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGGGSAWSHPQFEK
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington