2025-09-20_00000018_full_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 689346 | Complete | Structure prediction | RoseTTAFold | 2025-09-20_00000018_full_... | 38 | 20 Sep 2025 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 681357 | 1 | 1 | 0.93 | RoseTTAFold | 1-38 | 38 | 8 Oct 2025 |
1 . 10 . 20 . 30 .
sequence: MLPFVQERIGLFIVNFFIFTVVSAITLLVSMAFLTATR
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington