2025-09-27_00000277_full_11 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 689725 | Error | Structure prediction | cameo | 2025-09-27_00000277_full_... | 109 | 27 Sep 2025 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 681385 | 1 | 1 | n/a | TrRefineRosetta | 1-109 | 109 | 8 Oct 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 .
sequence: ANIAPRTVFFTIGSSELSPREEMNLSYLAAKMKEFPDTQYTVYGYADSATGTPAFNKELSQKRAQAVVNALVKKYGVDSSRLKVDAGGGVDKFGKPIYLNRVVLVESVK
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington