2025-10-04_00000329_full_11 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 690143 | Error | Structure prediction | cameo | 2025-10-04_00000329_full_... | 85 | 4 Oct 2025 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 681514 | 1 | 1 | n/a | TrRefineRosetta | 7-85 | 79 | 9 Oct 2025 |
10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 .
sequence: IRVRVQVQDHLFLIPVPHSSDTHSVAWLAEQAAQRYYQTCGLLPRLTLRKEGALLAPQDLIPDVLQSNDEVLAEVTSWD
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington