2025-10-18_00000258_full_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 691129 | Complete | Structure prediction | RoseTTAFold | 2025-10-18_00000258_full_... | 89 | 18 Oct 2025 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 682267 | 1 | 1 | 0.77 | RoseTTAFold | 11-89 | 79 | 18 Oct 2025 |
. 20 . 30 . 40 . 50 . 60 . 70 . 80 .
sequence: SSGLEVLFQGPGGTSVEELLEELRKLDPRVEELVRELVRKLREEGDPDKARFVADDALHLLRQGVSPEEIERHLRELLK
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington