2025-10-18_00000143_full_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 691135 | Complete | Structure prediction | RoseTTAFold | 2025-10-18_00000143_full_... | 134 | 18 Oct 2025 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 682273 | 1 | 1 | 0.77 | RoseTTAFold | 1-134 | 134 | 18 Oct 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130
sequence: MDPGLFGGFGSGGSGGSGGSGVTPLSLGVETKGGVMTVLIPRNTTIPTRKCEIFTTAEHNQTAVEIHVLQGERPMAQDNKSLGRFRLEGIPPMPAGVPQIEVCFDIDANGILHVTAKERSTGREASITIQNTTT
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington