keratin Domain 1 Parse 1 Confidence: 0.18

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
690761ExpiredStructure prediction Adhavankeratin6014 Oct 20253 Dec 2025
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
682330110.18ab initio1-606019 Oct 2025
             1   .   10    .   20    .   30    .   40    .   50    .   60
   sequence: MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSSRFSSG
 deepconcnf: --------E-----------------------EEE-------------------------
    psipred: -----------------------------EEEEEE---------------EEEEEEEE--
    spider3: ---EEEE-----------------------------------------------------
| Download | View
Powered by 3Dmol.js




Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington