E340V_omicron Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
690199ExpiredStructure prediction vg1124E340V_omicron1976 Oct 20253 Dec 2025
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
68237211n/acomparative modeling1-19719719 Oct 2025
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  
   sequence: TNLCPFDVVFNATRFASVYAWNRKRISNCVADYSVLYNLAPFFTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKVSGNYNYLYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGFNCYFPLRSYSFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKK
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington