WILD TYPE PIM1.pdb Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
690787ExpiredStructure prediction mythri_04WILD TYPE PIM1.pdb8514 Oct 20253 Dec 2025
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
68241511n/acomparative modeling1-858519 Oct 2025
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
   sequence: MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTR
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington