r247280h Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 691290 | Expired | Structure prediction | Tendayi | r247280h | 94 | 20 Oct 2025 | 4 Dec 2025 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 682466 | 1 | 1 | 0.41 | RoseTTAFold | 1-94 | 94 | 20 Oct 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90
sequence: KQIMDWPLFHRYVLGTNCKAYWSRPEDMFLQGVCSPTHNQWILYKDHAVMFPTGKRCYDWLTVPSQNHRGFLMCYVDAKWPQLNSRHGTQMVKD
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington