WILD TYPE PIM1.pdb Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
691360ExpiredStructure prediction mythri_04WILD TYPE PIM1.pdb8521 Oct 20255 Dec 2025
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
68255011n/acomparative modeling1-858521 Oct 2025
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
   sequence: MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTR
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington