Trans-BBB-2 Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 691410 | Expired | Structure prediction | kangrui Liu | Trans-BBB-2 | 37 | 22 Oct 2025 | 6 Dec 2025 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 682580 | 1 | 1 | 0.84 | RoseTTAFold | 1-37 | 37 | 22 Oct 2025 |
1 . 10 . 20 . 30 .
sequence: HAEGTFTSDVSSYLEEQAAKEFIAWLVKGHRPYIAHC
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington