CLGRMT Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 691543 | Complete | Structure prediction | SMandal | CLGRMT | 112 | 23 Oct 2025 | 7 Dec 2025 (46:35:45) |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 682700 | 1 | 1 | 0.79 | RoseTTAFold | 1-112 | 112 | 23 Oct 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110
sequence: MAALVREVVGDVLRGARMSQGRTLREVSDSARVSLGYLSEIERGRKEPSSELLSAICTALQLPLSVVLIDAGERMARQERLARATPAGRATGATIDASTKVVIAPVVSLAVA
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington