19Pg11_02119 19Pg9_00054 19Pg518_12_23_1_01237 Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 691564 | Complete | Structure prediction | manuel dentaid | 19Pg11_02119 19Pg9_00054 ... | 96 | 23 Oct 2025 | 7 Dec 2025 (51:31:17) |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 682724 | 1 | 1 | 0.79 | RoseTTAFold | 1-96 | 96 | 23 Oct 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 .
sequence: MKKTTNRRPSGAVKFYLACGLIFVGVVLLFSAFWVPPLGIIHESILVAFGEILTFSGALIGIDYTYRYKLLQLRSGLRELVRDEIVRETGEEDKEV
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington