| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 691671 | Complete | Structure prediction | pimba | 3I3Z_2 | 30 | 24 Oct 2025 | 8 Dec 2025 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 682818 | 1 | 1 | 0.82 | RoseTTAFold | 1-30 | 30 | 24 Oct 2025 |
1 . 10 . 20 . 30
sequence: FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington