MBD4 Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 691821 | Complete | Structure prediction | mowmita | MBD4 | 77 | 27 Oct 2025 | 11 Dec 2025 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 682936 | 1 | 1 | 0.78 | RoseTTAFold | 1-77 | 77 | 27 Oct 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 .
sequence: GTECRKSVPCGWERVVKQRLFGKTAGRFDVYFISPQGLKFRSKSSLANYLHKNGETSLKPEDFDFTVLSKRGIKSRY
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington