human insulin chain B Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 691842 | Complete | Structure prediction | Cyrus777 | human insulin chain B | 30 | 27 Oct 2025 | 11 Dec 2025 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 682953 | 1 | 1 | 0.82 | RoseTTAFold | 1-30 | 30 | 27 Oct 2025 |
1 . 10 . 20 . 30
sequence: FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington