bli2_intermediate Domain 1 Parse 1 Confidence: 0.17

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
691846CompleteStructure prediction HEMCHANDRAbli2_intermediate10027 Oct 202511 Dec 2025
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
682958110.17ab initio1-10010027 Oct 2025
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
   sequence: GFSSSKSSLAPGGQCCSCKTGPSGPPGPPGEDGRDGRDGKPGLNGEDGTDAKDSAPRRDAAAPCYDCPVGPPGPPGNIGSKGQPGRNGKDGLPGVPGLPG
 deepconcnf: ----------------------------------------------------------------------------------------------------
    psipred: ---------------EE-----------------------------------------------------------------------------------
    spider3: ----------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js
| | Alignment




Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington