| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 691970 | Active | Structure prediction | Zheng Li | preCLE1B | 73 | 29 Oct 2025 | 15 Dec 2025 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 683328 | 1 | 1 | 0.44 | comparative modeling | 23-73 | 51 | 31 Oct 2025 |
. 30 . 40 . 50 . 60 . 70
sequence: RSIDHVAHRRDRSLIESSKEMVKESIVRHEMTGGFNECFRLSPGGPDPRHH
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington