A1G1_360-398 Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 692286 | Complete | Structure prediction | Vrenili | A1G1_360-398 | 39 | 31 Oct 2025 | 15 Dec 2025 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 683363 | 1 | 1 | 0.94 | RoseTTAFold | 1-39 | 39 | 31 Oct 2025 |
1 . 10 . 20 . 30 .
sequence: HEGAKSETAEELKKVAQELEEKLNMLNNNYKILQADQEL
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington