FABPI_HUMAN Fatty acid-binding protein intestinal Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
692505ExpiredStructure prediction giovannapalermoFABPI_HUMAN Fatty acid-bi...1323 Nov 202518 Dec 2025
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
68353811n/acomparative modeling1-1321323 Nov 2025
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130  
   sequence: MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSTFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington