5c0z Domain 1 Parse 1 Confidence: 0.92

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
692728CompleteStructure prediction Mariana Trejo5c0z1054 Nov 202520 Dec 2025
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
683771110.92comparative modeling1-1051055 Nov 2025
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
   sequence: MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington