5M8L Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
693079ExpiredStructure prediction orgchemist5M8L317 Nov 202522 Dec 2025
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
68414611n/acomparative modeling1-31317 Nov 2025
             1   .   10    .   20    .   30 
   sequence: CKSGGAWCGFDPHGCCGNCGCLVGFCYGTGC
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington