anopheles 90-200 in 2POH Domain 1 Parse 1 Confidence: 0.30

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
693433CompleteStructure prediction ksh130anopheles 90-200 in 2POH11111 Nov 202526 Dec 2025
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
684492110.30comparative modeling1-11111111 Nov 2025
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110 
   sequence: QIPVPTPDEVRAGSGPATVKMEPVAQPPAAKESPKEQPPAKAQQKQSDSKPPKEKKPKKEKPAGGEGKPAAPAVEEPPIDVGRLDMRVGRIVEVSRHPDADSLYVEKIDCG
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington