peptide 2 Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 694890 | Expired | Structure prediction | maedeh | peptide 2 | 67 | 24 Nov 2025 | 8 Jan 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 685719 | 1 | 1 | 0.62 | RoseTTAFold | 1-67 | 67 | 24 Nov 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 .
sequence: SYSLLDKFDTNSNSVSFNLKKLEWSATNEEDDLAAYWADSRGPLEGEELEYGPGPGYGRKKRRQRRR
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington