| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 695168 | Complete | Structure prediction | dplatero | pep0 | 37 | 26 Nov 2025 | 10 Jan 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 685988 | 1 | 1 | 0.91 | RoseTTAFold | 1-37 | 37 | 26 Nov 2025 |
1 . 10 . 20 . 30 .
sequence: DWFKAFYDKVAEKFKEAFPDWFKAFYDKVAEKFKEAF
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington