peptide2_again Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 696199 | Complete | Structure prediction | Jonathan Guillermo | peptide2_again | 43 | 9 Dec 2025 | 23 Jan 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 686875 | 1 | 1 | 0.75 | RoseTTAFold | 1-43 | 43 | 9 Dec 2025 |
1 . 10 . 20 . 30 . 40
sequence: KRCLGENVPCGPSKVSTCCSPLKCEETFGYGWWYASPYCVKSK
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington